产品详情
PLA2G12 Human
Secreted Phospholipase A2-XII Human Recombinant
Catalog No. ENZ-330
Synonyms:
Group XIIA secretory phospholipase A2, EC 3.1.1.4, Phosphatidylcholine 2-acylhydrolase GXII, GXII sPLA2, PLA2G12, sPLA2-XII, PLA2G12A.
Introduction:
Phospholipase A2 (PLA2) catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to liberate arachidonic acid (AA), a precursor of eicosanoids including prostaglandins and leukotrienes. The same reaction also produces lysophosholipids, which represent another class of lipid mediators.
The secretory PLA2 (sPLA2) family, in which 10 isozymes have been identified, consists of low molecular weight, Ca2+-requiring secretory enzymes that have been implicated in a number of biological processes, such as modification of eicosanoid generation, inflammation, and host defense.
This enzyme has been proposed to hydrolyze phosphatidylcholine (PC) in lipoproteins to liberate lyso- PC and free fatty acids in the arterial wall, thereby facilitating the accumulation of bioactive lipids and modified lipoproteins in atherosclerotic foci.
In mice, sPLA2 expression significantly influences HDL particle size and composition and demonstrate that an induction of sPLA2 is required for the decrease in plasma HDL cholesterol in response to inflammatory stimuli. Instillation of bacteria into the bronchi was associated with surfactant degradation and a decrease in large:small ratio of surfactant aggregates in rats.
Description:
Secreted Phospholipase A2-XII Human Recombiannt was produced with N-terminal His-Tag. PLA2G12 His-Tagged Fusion Protein is 20.6 kDa containing 167 amino acid residues of the human secreted phospholipase A2-XII and 16 additional amino acid residues – His-Tag (underlined).
MRGSHHHHHHGMASHMQEQAQTTDWRATLKTIRNGVHKIDTYLNAALDLL
GGEDGLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNQ
HDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFD
SVIHLGCKPYLDSQRAACRCHYEEKTDL
Source:
Escherichia Coli.
Physical Appearance:
Sterile Filtered lyophilized (freeze-dried) powder.
Formulation:
Sterile filtered and lyophilized from 0.5 mg/ml in 0.01M Tris buffer pH 8.6.
Solubility:
Add 0.2 ml of deionized water and let the lyophilized pellet dissolve completely.
Stability:
Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
The lyophilized protein remains stable until the expiry date when stored at -20°C.
Specificity:
The amino acid sequence of the recombinant human Secreted Phospholipase A2-XII is 100% homologous to the amino acid sequence of the human Secreted Phospholipase A2-XII without signal sequence.
Purification Method:
Ni-NTA affinity chromatography.
Purity:
Greater than 95% as determined by SDS PAGE.
Applications:
Western blotting
Usage:
Prospec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Related Products
» HRASLS3 Human
» PLA2G10 Human
» PLA2G1B Human
» PLA2G2A Human
» PLA2G2D Human
» PLA2G2E Human
» PLA2G5 Human
» PLA2G7 Human